Home / Products / proteins / Troponin C 1-160aa, Human, Recombinant, E.coli

Troponin C 1-160aa, Human, Recombinant, E.coli

Categories: [Proteins / Peptides]
Troponin C, skeletal muscle, also known as TNNC2, is the central regulatory protein of striated muscle contraction, and modulates the Ca2+-activation characteristics of muscle fibers. Troponin has 3 subunits, Troponin I(Tn-1), Troponin T(Tn-T) and Troponin C(Tn-C). Tn-I subunit inhibits actomyosin ATPase and Tn-T subunit binds tropomyosin and Tn-C, while Tn-C subunit binds calcium and overcomes the inhibitory action of the troponin complex on actin filaments. Mutations in all components of this complex have been associated with skeletal muscle disease. Recombinant human Troponin C was expressed in E.coli and purified by using conventional chromatography.
List Price: $365
  • Buy 5 for $346.75 each and save 5%
  • Buy 21 for $328.5 each and save 10%
  • Buy 31 for $310.25 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP04312
Size 100 µg
Host E.coli
Accession
Molecular Weight 18.1 kDa (160aa), confirmed by MALDI-TOF.
AP_Mol_Weight
Tag
Sequences MTDQQAEARSYLSEEMIAEFKAAFDMFDADGGGDISVKELGTVMRMLGQTPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMKEDAKGKSEEELAECFRIFDRNADGYIDPEELAEIFRASGEHVTDEEIESLMKDGDKNNDGRIDFDEFLKMMEGVQ
Purity > 95% by HPLC
Concentration 1 mg/ml (determined by Bradford assay)
Formulation Liquid. In 20 mM Tris-HCl buffer (pH 7.5) containing 1mM DTT, 100mM NaCl, 10% glycerol.
Other Names Troponin C, skeletal muscle, TNNC2, Troponin C, skeletal muscle TNNC1, Cardiac troponin C, TNNC, Troponin C1 slow, Fast skeletal muscle troponin C, Skeletal troponin C, Troponin C type 1 (slow)
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.
CONTACT US
How to order

Featured Products

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap