TREM2, 19-161aa, Human, His tag, E.coli

Categories: [Proteins / Peptides]
TREM2 is a membrane protein that forms a receptorsignaling complex with the TYRO protein tyrosine kinase bindingprotein. The protein functions in immune response and maybe involved in chronic inflammation by triggering the production ofconstitutive inflammatory cytokines. Defects in this gene are acause of polycystic lipomembranous osteodysplasia with sclerosingleukoencephalopathy (PLOSL). Alternative splicing results in multiple transcript variants encoding different isoforms. Recombinant human TREM2 protein, fused to His-tag at N-terminus, was expressed in E.coli and purified by using conventional chromatography techniques.
List Price: $310
  • Buy 5 for $294.5 each and save 5%
  • Buy 21 for $279 each and save 10%
  • Buy 31 for $263.5 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP04307
Size 50 µg
Host E.coli
Accession
Molecular Weight 20.4kDa (181aa) confirmed by MALDI-TOF
AP_Mol_Weight
Tag N-6His
Sequences MRGSHHHHHHGMASMTGGQQMGRDLYDDDDKDRWGSHMHNTTVFQGVAGQSLQVSCPYDSMKHWGRRKAWCRQLGEKGPCQRVVSTHNLWLLSFLRRWNGSTAITDDTLGGTLTITLRNLQPHDAGLYQCQSLHGSEADTLRKVLVEVLADPLDHRDAGDLWFPGESESFEDAHVEHSISR
Purity > 95% by HPLC
Concentration 0.25 mg/ml (determined by Bradford assay)
Formulation Liquid. In 20mM Tris-HCl buffer (pH 8.0) containing 0.15M NaCl, 10% glycerol, 1mM DTT
Other Names Triggering receptor expressed on myeloid cells 2, Trem2a, Trem2b, Trem2c
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap