TPSAB1, 31-275aa, Human, His tag, E.coli

Categories: [Proteins / Peptides]
TPSAB1, also known as tryptase alpha/beta-1, is a tryptase that is the major neutral protease present in mast cells and is secreted upon the coupled activation-degranulation response of this cell type. It is enzymatically active only as a heparin-stabilized tetramer, and it is resistant to all known an endogenous proteinase inhibitor. This protein has been implicated as mediators in the pathogenesis of asthma and other allergic and inflammatory disorders. Recombinant human TPSAB1 protein, fused to His-tag at N-terminus, was expressed in E.coli.
List Price: $310
  • Buy 5 for $294.5 each and save 5%
  • Buy 21 for $279 each and save 10%
  • Buy 31 for $263.5 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP04291
Size 50 µg
Host E.coli
Accession
Molecular Weight 30.1 kDa(270aa)
AP_Mol_Weight
Tag N-6His
Sequences MGSSHHHHHHSSGLVPRGSHMGSHMIVGGQEAPRSKWPWQVSLRVHGPYWMHFCGGSLIHPQWVLTAAHCVGPDVKDLAALRVQLREQHLYYQDQLLPVSRIIVHPQFYTAQIGADIALLELEEPVNVSSHVHTVTLPPASETFPPGMPCWVTGWGDVDNDERLPPPFPLKQVKVPIMENHICDAKYHLGAYTGDDVRIVRDDMLCAGNTRRDSCQGDSGGPLVCKVNGTWLQAGVVSWGEGCAQPNRPGIYTRVTYYLDWIHHYVPKKP
Purity > 95% by HPLC
Concentration 1.0 mg/ml (determined by Bradford assay)
Formulation Liquid. 20mM Tris-HCl buffer (pH8.0) containing 10% glycerol 0.4M Urea
Other Names Tryptase alpha/beta-1, TPS1, TPS2, TPSB1
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap