Home / Products / proteins / TPD52L1, Human, Recombinant, His-tag, E.coli

TPD52L1, Human, Recombinant, His-tag, E.coli

Categories: [Proteins / Peptides]
TPD52L1(hD53,hD53L1) is a member of D52 gene family and overexpressed in human breast carcinoma. This protein contains coiled-coil motif, which is responsible for homo- and heteromeric interaction, and may be a regulator of cell proliferation and calcium-mediated signal transduction. TPD52L1, fused to His-tag at N-terminus, was overexpressed in E. coli and purified by using conventional chromatography techniques.
List Price: $473
  • Buy 5 for $449.35 each and save 5%
  • Buy 21 for $425.7 each and save 10%
  • Buy 31 for $402.05 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP04279
Size 100 µg
Host E.coli
Accession
Molecular Weight 16.8 kDa (151 aa), confirmed by MALDI-TOF.
AP_Mol_Weight
Tag
Sequences MGSSHHHHHHSSGLVPRGSHMEAQAQGLLETEPLQGTDEDAVASADFSSMLSEEEKEELKAELVQLEDEITTLRQVLSAKERHLVEIKQKLGMNLMNELKQNFSKSWHDMQTTTAYKKTHETLSHAGQKATAAFSNVGTAISKKFGDMRRK
Purity > 95% by HPLC
Concentration 1 mg/ml (determined by Bradford assay)
Formulation Liquid. In PBS (pH 7.4)
Other Names Tpd52l1, TPD52L1 , mD53, Tumor protein D52-like 1, Tumor protein D53, Tumor protein D52-like 1 isoform 4 D53, D54, hD53, hD54, MGC73020, MGC8556, TPD52L2, Tumor protein D52 like 1, Tumor protein D52 like 2, Tumor protein D53, Tumor protein D54,
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.
CONTACT US
How to order

Featured Products

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap