TNFSF8, 63-234aa, Human, His tag, Baculovirus

Categories: [Proteins / Peptides]
TNFSF8, also known as tumor necrosis factor ligand superfamily member 8, is a type II membrane protein belonging to the TNF superfamily. It is expressed on the cell surface of activated T cells, B cells, and monocytes. CD30/TNFRSF8 ligation by TNFSF8 mediates pleiotropic effects including cell proliferation, activation, differentiation and cell death by apoptosis. Recombinant human TNFSF8, fused to His-tag at C-terminus, was expressed in insect cell and purified by using conventional chromatography techniques.
List Price: $216
  • Buy 5 for $205.2 each and save 5%
  • Buy 21 for $194.4 each and save 10%
  • Buy 31 for $183.6 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP04267
Size 20 µg
Host Baculovirus
Accession
Molecular Weight 20.7kDa (181aa), 18-40KDa (SDS-PAGE under reducing conditions.)
AP_Mol_Weight
Tag N-6His
Sequences ADPQRTDSIPNSPDNVPLKGGNCSEDLLCILKRAPFKKSWAYLQVAKHLNKTKLSWNKDGILHGVRYQDGNLVIQFPGLYFIICQLQFLVQCPNNSVDLKLELLINKHIKKQALVTVCESGMQTKHVYQNLSQFLLDYLQVNTTISVNVDTFQYIDTSTFPLENVLSIFLYSNSDHHHHHH
Purity > 95% by HPLC
Concentration 0.5mg/ml (determined by Absorbance at 280nm)
Formulation Liquid. In Phosphate Buffered Saline (pH 7.4) containing 10% glycerol.
Other Names Tumor necrosis factor ligand superfamily member 8, TNFSF8, CD153, CD30L, CD30LG, TNLG3A
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap