Home / Products / proteins / TNFSF18, 81-199aa, Human, T7-tagged, Recombinant, E.coli

TNFSF18, 81-199aa, Human, T7-tagged, Recombinant, E.coli

Categories: [Proteins / Peptides]
TNFSF18 is a cytokine that belongs to the tumor necrosis factor (TNF) ligand family. This cytokine is a ligand for receptor TNFRSF18/AITR/GITR. It has been shown to modulate T lymphocyte survival in peripheral tissues. This cytokine is also found to be expressed in endothelial cells, and is thought to be important for interaction between T lymphocytes and endothelial cells. Recombinant human TNFSF18 protein, fused to T7-tag at N-terminus, was expressed in E.coli.
List Price: $280
  • Buy 5 for $266 each and save 5%
  • Buy 21 for $252 each and save 10%
  • Buy 31 for $238 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP04265
Size 50 µg
Host E.coli
Accession
Molecular Weight 15.0 kDa (134 aa)
AP_Mol_Weight
Tag
Sequences MASMTGGQQMGRGSHMAKFGPLPSKWQMASSEPPCVNKVSDWKLEILQNGLYLIYGQVAPNANYNDVAPFEVRLYKNKDMIQTLTNKSKIQNVGGTYELHVGDTIDLIFNSEHQVLKNNTYWGIILLANPQFIS
Purity > 95% by HPLC
Concentration 0.25 mg/ml (determined by Bradford assay)
Formulation Liquid. In 20mM Tris-HCl buffer (pH 8.0) containing 10% glycerol, 0.4M Urea
Other Names Tumor necrosis factor (ligand) superfamily, member 18, AITRL, TL6, GITRL, hGITRL.
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.
CONTACT US
How to order

Featured Products

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap