TNFSF18, 72-199aa, Human, E.coli

Categories: [Proteins / Peptides]
TNFSF18, also known as GITRL, belongs to the tumor necrosis factor(TNF) ligand family. This cytokine is a ligand for receptor TNFRSF18/AITR/GITR. It is Important for interactions between activated T-lymphocytes and endothelial cells and may modulate T-lymphocyte survival in peripheral tissues. This cytokine is also found to be expressed in endothelial cells, and is thought to be important for interaction between T lymphocytes and endothelial cells. Recombinant human TNFSF18 protein was expressed in E.coli and purified by conventional chromatography, after refolding of the isolated inclusion bodies in a renaturation buffer.
List Price: $280
  • Buy 5 for $266 each and save 5%
  • Buy 21 for $252 each and save 10%
  • Buy 31 for $238 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP04264
Size 100 µg
Host E.coli
Accession
Molecular Weight 14.6kDa (129aa), confirmed by MALDI-TOF
AP_Mol_Weight
Tag
Sequences MQLETAKEPCMAKFGPLPSKWQMASSEPPCVNKVSDWKLEILQNGLYLIYGQVAPNANYNDVAPFEVRLYKNKDMIQTLTNKSKIQNVGGTYELHVGDTIDLIFNSEHQVLKNNTYWGIILLANPQFIS
Purity > 95% by HPLC
Concentration 0.5mg/ml (determined by Bradford assay)
Formulation Liquid. In 10mM sodium citrate (pH 3.5), 10% glycerol, 1mMDTT
Other Names Tumor necrosis factor (ligand) superfamily member 18, AITRL, TL6, GITRL, hGITRL
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap