TNFSF18, 50-177aa , Human, His tag, E.coli

Categories: [Proteins / Peptides]
TNFSF18 also known as tumor necrosis factor ligand superfamily member 18 belongs to the tumor necrosis factor (TNF) ligand family. This cytokine is a ligand for receptor TNFRSF18/AITR/GITR. It has been shown to modulate T lymphocyte survival in peripheral tissues. This cytokine is also found to be expressed in endothelial cells, and is thought to be important for interaction between T lymphocytes and endothelial cells. Recombinant human TNFSF18 protein, fused to His-tag at C-terminus, was expressed in E.coli.
List Price: $216
  • Buy 5 for $205.2 each and save 5%
  • Buy 21 for $194.4 each and save 10%
  • Buy 31 for $183.6 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP04263
Size 100 µg
Host E.coli
Accession
Molecular Weight 15.6kDa (137aa)
AP_Mol_Weight
Tag N-6His
Sequences MQLETAKEPCMAKFGPLPSKWQMASSEPPCVNKVSDWKLEILQNGLYLIYGQVAPNANYNDVAPFEVRLYKNKDMIQTLTNKSKIQNVGGTYELHVGDTIDLIFNSEHQVLKNNTYWGIILIANPQEISLEHHHHHH
Purity > 95% by HPLC
Concentration 1mg/ml (determined by Bradford assay)
Formulation Liquid, In 20mM Tris-HCl buffer(pH8.0) containing 10% glycerol
Other Names Tumor necrosis factor ligand superfamily member 18, AITRL, GITRL, hGITRL, TL6
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap