TNFSF15, 72-251aa, Human, His tag, E.coli

Categories: [Proteins / Peptides]
Tumor necrosis factor ligand superfamily member 15, also known TNFSF15, belongs to the TNF superfamily. TNFSF15 is predominantly expressed in endothelial cells and its expression is inducible by TNFalpha and IL1alpha. TNFSF15 is an angiogenesis inhibitor of the TNF family and functions in part by directly inhibiting endothelial cell proliferation. TNFSF15 may act as an autocrine factor to induce apoptosis in endothelial cells via activation of multiple signaling pathways, including stress protein kinases and certain caspases. Recombinant human TNFSF15 protein, fused to His-tag at N-terminus, was expressed in E.coli and purified by using conventional chromatography techniques.
List Price: $365
  • Buy 5 for $346.75 each and save 5%
  • Buy 21 for $328.5 each and save 10%
  • Buy 31 for $310.25 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP04262
Size 100 µg
Host E.coli
Accession
Molecular Weight 22.7 kDa (201aa) confirmed by MALDI-TOF
AP_Mol_Weight
Tag N-6His
Sequences MGSSHHHHHHSSGLVPRGSHMLKGQEFAPSHQQVYAPLRADGDKPRAHLTVVRQTPTQHFKNQFPALHWEHELGLAFTKNRMNYTNKFLLIPESGDYFIYSQVTFRGMTSECSEIRQAGRPNKPDSITVVITKVTDSYPEPTQLLMGTKSVCEVGSNWFQPIYLGAMFSLQEGDKLMVNVSDISLVDYTKEDKTFFGAFLL
Purity > 95% by HPLC
Concentration 1 mg/ml (determined by Bradford assay )
Formulation Liquid. In 20mM Tris-HCl buffer (pH 8.0) containing 1mM DTT, 50% glycerol, 0.2M NaCl
Other Names Tumor necrosis factor ligand superfamily member 15, TL1, TL1A, VEGI, VEGI192A
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap