TNFRSF9, 18-186aa, Human, His tag, E.coli

Categories: [Proteins / Peptides]
TNFRSF9, also known as CD137 or ILA, is a member of the TNF superfamily of receptors. This protein is mainly expressed on the surface of a variety of T cells, but also found in B cells, monocytes, and various transformed cell lines. TNFRSF9 is expressed on activated T cells and binds an inducible ligand that is found on B cells, macrophages and dendritic cells. Recombinant human TNFRSF9 protein, fused to His-tag at N-terminus, was expressed in E.coli and purified by using conventional chromatography techniques.
List Price: $487
  • Buy 5 for $462.65 each and save 5%
  • Buy 21 for $438.3 each and save 10%
  • Buy 31 for $413.95 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP04259
Size 100 µg
Host E.coli
Accession
Molecular Weight 20 kDa (193aa), confirmed by MALDI-TOF
AP_Mol_Weight
Tag N-6His
Sequences MGSSHHHHHHSSGLVPRGSHMGSMFERTRSLQDPCSNCPAGTFCDNNRNQICSPCPPNSFSSAGGQRTCDICRQCKGVFRTRKECSSTSNAECDCTPGFHCLGAGCSMCEQDCKQGQELTKKGCKDCCFGTFNDQKRGICRPWTNCSLDGKSVLVNGTKERDVVCGPSPADLSPGASSVTPPAPAREPGHSPQ
Purity > 95% by HPLC
Concentration 0.5 mg/ml (determined by Bradford assay)
Formulation Liquid. In 20mM Tris-HCl buffer (pH 8.0) containing 0.1M NaCl, 10% glycerol,1mM DTT
Other Names Tumor necrosis factor receptor superfamily, member 9, 4-1BB ligand receptor, CD137, CDw137, ILA
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap