Home / Products / proteins / TNFRSF1A, 41-201aa, Human, His tag, E.coli

TNFRSF1A, 41-201aa, Human, His tag, E.coli

Categories: [Proteins / Peptides]
TNFRSF1A is a member of the tumor necrosis factor receptor superfamily. This protein is one of the major receptors for the tumor necrosis factor-alpha. This receptor can activate the transcription factor NF-kB, mediate apoptosis, and function as a regulator of inflammation. It plays regulatory roles in the signal transduction mediated by the receptor. Recombinant human TNFRSF1A protein, fused to His-tag at N-terminus, was expressed in E.coli.
List Price: $365
  • Buy 5 for $346.75 each and save 5%
  • Buy 21 for $328.5 each and save 10%
  • Buy 31 for $310.25 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP04253
Size 100 µg
Host E.coli
Accession
Molecular Weight 20.8 kDa(186aa)
AP_Mol_Weight
Tag N-6His
Sequences MGSSHHHHHHSSGLVPRGSHMGSHMDSVCPQGKYIHPQNNSICCTKCHKGTYLYNDCPGPGQDTDCRECESGSFTASENHLRHCLSCSKCRKEMGQVEISSCTVDRDTVCGCRKNQYRHYWSENLFQCFNCSLCLNGTVHLSCQEKQNTVCTCHAGFFLRENECVSCSNCKKSLECTKLCLPQIEN
Purity > 95% by HPLC
Concentration 1.0 mg/ml (determined by Bradford assay)
Formulation Liquid. 20mM Tris-HCl buffer (pH8.0) containing 10% glycerol 2M Urea
Other Names Tumor necrosis factor receptor superfamily member 1A, CD120a, FPF, p55, p55-R, p60, TBP1, TNF-R, TNF-R-I, TNF-R55, TNFAR, TNFR1, TNFR55, TNFR60
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.
CONTACT US
How to order

Featured Products

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap