TNFRSF18, 26-162aa, Human, hIgG-His tag, Baculovirus

Categories: [Proteins / Peptides]
TNFRSF18, also known as tumor necrosis factor receptor superfamily member 18 isoform 1, is receptor for TNFSF18. It seems to be involved in interactions between activated T-lymphocytes and endothelial cells and in the regulation of T-cell receptor-mediated cell death. TNFRSF18 mediated NF-kappa-B activation via the TRAF2/NIK pathway. Also, this protein reciprocally stimulated and activate intracellular signals regulating immune functions. In particular, GITR-driven T-cell co-stimulation was found to be the main mechanism by which the GITRL-GITR system contributes to tumor rejection and the development of autoimmune/inflammatory diseases.
List Price: $216
  • Buy 5 for $205.2 each and save 5%
  • Buy 21 for $194.4 each and save 10%
  • Buy 31 for $183.6 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP04250
Size 50 µg
Host Baculovirus
Accession
Molecular Weight 41.6kDa (376aa), 40-57KDa (SDS-PAGE under reducing conditions.)
AP_Mol_Weight
Tag N-6His
Sequences QRPTGGPGCGPGRLLLGTGTDARCCRVHTTRCCRDYPGEECCSEWDCMCVQPEFHCGDPCCTTCRHHPCPPGQGVQSQGKFSFGFQCIDCASGTFSGGHEGHCKPWTDCTQFGFLTVFPGNKTHNAVCVPGSPPAEPLEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGKHHHHHH
Purity > 95% by HPLC
Concentration 0.5mg/ml (determined by Absorbance at 280nm)
Formulation Liquid. In Phosphate Buffered Saline (pH 7.4) containing 10% glycerol.
Other Names Tumor necrosis factor receptor superfamily member 18 isoform 1, AITR, CD357, GITR, GITR-D
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap