TNFRSF13B, 1-165aa, Human, His tag, E.coli

Categories: [Proteins / Peptides]
TNFRSF13B, also known as TACI, is a transmembrane receptor protein found predominantly on the surface of B cells, which are an important part of the immune system. It was originally discovered because of its ability to interact with calcium-modulator and cyclophilin ligand (CAML). It was later found to play a crucial role in humoral immunity by interacting with two members of the TNF family. It controls T cell-independent B cell antibody responses, isotype switching, and B cell homeostasis. Recombinant human TNFRSF13B protein, fused to His-tag at N-terminus, was expressed in E.coli.
List Price: $365
  • Buy 5 for $346.75 each and save 5%
  • Buy 21 for $328.5 each and save 10%
  • Buy 31 for $310.25 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP04246
Size 100 µg
Host E.coli
Accession
Molecular Weight 20.9 kDa(188aa)
AP_Mol_Weight
Tag N-6His
Sequences MGSSHHHHHHSSGLVPRGSHMGSMSGLGRSRRGGRSRVDQEERFPQGLWTGVAMRSCPEEQYWDPLLGTCMSCKTICNHQSQRTCAAFCRSLSCRKEQGKFYDHLLRDCISCASICGQHPKQCAYFCENKLRSPVNLPPELRRQRSGEVENNSDNSGRYQGLEHRGSEASPALPGLKLSADQVALVYS
Purity > 95% by HPLC
Concentration 1 mg/ml (determined by Bradford assay)
Formulation Liquid. 20mM Tris-HCl buffer (pH8.0) containing 10% glycerol 0.4M Urea
Other Names Tumor necrosis factor receptor superfamily member 13B, CD267, CVID, CVID2, TACI, TNFRSF14B
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap