TNFRSF13B, 1-165aa, Human, hIgG His tag, Baculovirus

Categories: [Proteins / Peptides]
TNFRSF13B, also known as tumor necrosis factor receptor superfamily member 13B, is a member of the tumor necrosis factor receptor superfamily. It is a trimeric cytokine receptor that binds tumor necrosis factors (TNF). It cooperates with an adaptor protein which is important in determining the outcome of the response. It has crucial roles in both innate and adaptive immunity and in cellular apoptosis process. Recombinant human TNFRSF13B, fused to hIgG-His-tag at C-terminus, was expressed in insect cell and purified by using conventional chromatography techniques.
List Price: $402
  • Buy 5 for $381.9 each and save 5%
  • Buy 21 for $361.8 each and save 10%
  • Buy 31 for $341.7 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP04245
Size 50 µg
Host Baculovirus
Accession
Molecular Weight 45.8kDa (407aa), 25-50kDa (SDS-PAGE under reducing conditions)
AP_Mol_Weight
Tag N-6His
Sequences ADLMSGLGRSRRGGRSRVDQEERFPQGLWTGVAMRSCPEEQYWDPLLGTCMSCKTICNHQSQRTCAAFCRSLSCRKEQGKFYDHLLRDCISCASICGQHPKQCAYFCENKLRSPVNLPPELRRQRSGEVENNSDNSGRYQGLEHRGSEASPALPGLKLSADQVALVYSLEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGKHHHHHH
Purity > 95% by HPLC
Concentration 0.25mg/ml (determined by Absorbance at 280nm)
Formulation Liquid. In Phosphate Buffered Saline (pH 7.4) containing 30% glycerol, 1mM DTT.
Other Names Tumor necrosis factor receptor superfamily member 13B, TNFRSF13B, CD267, CVID, CVID2, IGAD2, RYZN, TACI, TNFRSF14B, CD 267, CD267 antigen,.
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap