TANK, 1-119 aa, Human, Recombinant, E.coli

Categories: [Proteins / Peptides]
TANK, also known as TRAF(tumor necrosis factor receptor-associated Factor)-interacting protein, is found in the cytoplasm and can bind to TRAF1, TRAF2, or TRAF3, thereby proposing that this protein is an inhibitor of TRAF function that regulates TRAF protein activity by sequestering TRAFs in a latent state in the cytoplasm. Overexpression of TANK inhibits TRAF2-mediated NF-Kappa-B activation signaled by CD40 and both TNF receptors and inhibits LMP1-mediated NF-kappa-B activation by blocking the association of TRAF2 with LMP1. Recombinant human TANK protein was expressed in E.coli and purified by using conventional chromatography techniques.
List Price: $329
  • Buy 5 for $312.55 each and save 5%
  • Buy 21 for $296.1 each and save 10%
  • Buy 31 for $279.65 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP04142
Size 100 µg
Host E.coli
Accession
Molecular Weight 13.6 kDa (119 aa), confirmed by MALDI-TOF.
AP_Mol_Weight
Tag
Sequences MDKNIGEQLNKAYEAFRQACMDRDSAVKELQQKTENYEQRIREQQEQLSLQQTIIDKLKSQLLLVNSTQDNNYGCVPLLEDSETRKNNLTLDQPQDKVISGIAREKLPKVDIASAESSI
Purity > 95% by HPLC
Concentration 1 mg/ml (determined by Bradford assay)
Formulation Liquid. In 20mM Tris-HCl buffer (pH8.0)
Other Names TRAF interacting protein TANK isoform b, I-TRAF, TRAF2, TRAF interacting protein TANK isoform b I TRAF, ITRAF, TRAF interacting protein, TRAF family member associated NF KAPPA B activator, TRAF family member associated NFKB activator
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap