TAGLN3, 1-199aa, Human, His tag, E.coli

Categories: [Proteins / Peptides]
TAGLN3, also known as transgelin-3, contains a putative Actin-binding domain, two EF-hand motifs, two potential phosphorylation sites and a calponin-homology (CH) domain. It shares homology with transgelin and calponin, two cytoskeleton-interacting proteins. Belonging to the calponin family, TAGLN3 co-localizes with Actin and tubulin, suggesting a possible role for it in neuronal plasticity or as a signaling protein. Due to a varied expression pattern, it may play different roles in the developing and adult brain. Recombinant human TAGLN3 protein, fused to His-tag at N-terminus, was expressed in E.coli and purified by using conventional chromatography.
List Price: $365
  • Buy 5 for $346.75 each and save 5%
  • Buy 21 for $328.5 each and save 10%
  • Buy 31 for $310.25 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP04140
Size 100 µg
Host E.coli
Accession
Molecular Weight 24.6 kDa (219aa), confirmed by MALDI-TOF
AP_Mol_Weight
Tag N-6His
Sequences MGSSHHHHHHSSGLVPRGSHMANRGPSYGLSREVQEKIEQKYDADLENKLVDWIILQCAEDIEHPPPGRAHFQKWLMDGTVLCKLINSLYPPGQEPIPKISESKMAFKQMEQISQFLKAAETYGVRTTDIFQTVDLWEGKDMAAVQRTLMALGSVAVTKDDGCYRGEPSWFHRKAQQNRRGFSEEQLRQGQNVIGLQMGSNKGASQAGMTGYGMPRQIM
Purity > 95% by HPLC
Concentration 0.5 mg/ml (determined by Bradford assay)
Formulation Liquid. 20mM Tris-HCl buffer (pH8.0) containing 20% glycerol, 1mM DTT
Other Names Transgelin-3, NP22, NP25
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap