TAGLN, 1-201aa, Human, His tag, E.coli

Categories: [Proteins / Peptides]
TAGLN is a transformation and shape-change sensitive actin cross-linking/gelling protein that belongs to the calponin family. This protein is expressed abundantly in fibroblasts and smooth muscle. It is involved in calcium interactions and contractile properties of the cell that may contribute to replicative senescence. During embryogenesis, TAGLN is expressed in smooth, cardiac and skeletal muscle, but is restricted during late fetal development and adulthood to all vascular and visceral smooth muscle cells and low levels of expression in heart. It is downregulated in several transformed cell lines, indicating that a reduction of TAGLN expression may be an early indicator of the onset of transformation. Recombinant human TAGLN protein, fused to his-tag at N-terminus was expressed in E.coli and purified by using conventional chromatography techniques
List Price: $316
  • Buy 5 for $300.2 each and save 5%
  • Buy 21 for $284.4 each and save 10%
  • Buy 31 for $268.6 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP04138
Size 100 µg
Host E.coli
Accession
Molecular Weight 24.8 kDa (221aa) confirmed by MALDI-TOF
AP_Mol_Weight
Tag N-6His
Sequences MGSSHHHHHHSSGLVPRGSHMANKGPSYGMSREVQSKIEKKYDEELEERLVEWIIVQCGPDVGRPDRGRLGFQVWLKNGVILSKLVNSLYPDGSKPVKVPENPPSMVFKQMEQVAQFLKAAEDYGVIKTDMFQTVDLFEGKDMAAVQRTLMALGSLAVTKNDGHYRGDPNWFMKKAQEHKREFTESQLQEGKHVIGLQMGSNRGASQAGMTGYGRPRQIIS
Purity > 95% by HPLC
Concentration 1 mg/ml (determined by Bradford assay)
Formulation Liquid. In 20mM Tris-HCl buffer(pH 8.0) containing 20% glycerol 1mM DTT
Other Names SM22, SMCC, TAGLN1, WS3-10, Transgelin, SM 22, SM22 alpha, SMCC, Smooth muscle protein 22-alpha, WS3 10
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap