TAF9, 1-172aa, Human, His tag, E.coli

Categories: [Proteins / Peptides]
TAF9, also known as TATA box binding protein (TBP)-associated factor, is a general transcription factor that facilitates the preinitiation complex assembly through direct interactions with the TATA promoter element. It is a multisubunit complex consisting of a small TATA-binding polypeptide and other TBP-associated factors (TAFs). It acts as a channel for regulatory signals. Recombinant human TAF9 protein, fused to His-tag at N-terminus, was expressed in E.coli and purified by using conventional chromatography.
List Price: $365
  • Buy 5 for $346.75 each and save 5%
  • Buy 21 for $328.5 each and save 10%
  • Buy 31 for $310.25 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP04137
Size 100 µg
Host E.coli
Accession
Molecular Weight 22.2 kDa (192aa) confirmed by MALDI-TOF (Molecular weight on SDS-PAGE will appear higher)
AP_Mol_Weight
Tag N-6His
Sequences MGSSHHHHHHSSGLVPRGSHMLLPNILLTGTPGVGKTTLGKELASKSGLKYINVGDLAREEQLYDGYDEEYDCPILDEDRVVDELDNQMREGGVIVDYHGCDFFPERWFHIVFVLRTDTNVLYERLETRGYNEKKLTDNIQCEIFQVLYEEATASYKEEIVHQLPSNKPEELENNVDQILKWIEQWIKDHNS
Purity > 95% by HPLC
Concentration 0.5 mg/ml (determined by Bradford assay)
Formulation Liquid. 20mM Tris-HCl buffer (pH8.0) containing 10% glycerol 1mM DTT
Other Names Adenylate kinase isoenzyme 6, AD-004, AK6, CGI-137, CINAP, CIP, hCINAP, MGC1603, MGC3647, MGC5067
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap