TACSTD2, 31-274aa, Human, His-tag, Baculovirus

Categories: [Proteins / Peptides]
TACSTD2, also known as tumor-associated calcium signal transducer 2, is an identified cell surface glycoprotein highly expressed by human carcinomas. It is detected in normal kidney, lung, ovary and testis, similarly to the human gene. It is undetectable in undifferentiated spindle cell carcinomas, this suggests a preferential expression at early stages of tumor progression. Its inhibition suppresses the proliferation and invasion of laryngeal carcinoma cells via the extracellular signal-regulated kinase/mitogen-activated protein kinase pathway. Recombinant human TACSTD2, fused to His-tag at C-terminus, was expressed in insect cell and purified by using conventional chromatography techniques.
List Price: $302
  • Buy 5 for $286.9 each and save 5%
  • Buy 21 for $271.8 each and save 10%
  • Buy 31 for $256.7 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP04134
Size 50 µg
Host Baculovirus
Accession
Molecular Weight 28.6kDa (253aa), 28-40kDa (SDS-PAGE under reducing conditions)
AP_Mol_Weight
Tag
Sequences ADPQDNCTCPTNKMTVCSPDGPGGRCQCRALGSGMAVDCSTLTSKCLLLKARMSAPKNARTLVRPSEHALVDNDGLYDPDCDPEGRFKARQCNQTSVCWCVNSVGVRRTDKGDLSLRCDELVRTHHILIDLRHRPTAGAFNHSDLDAELRRLFRERYRLHPKFVAAVHYEQPTIQIELRQNTSQKAAGDVDIGDAAYYFERDIKGESLFQGRGGLDLRVRGEPLQVERTLIYYLDEIPPKFSMKRLTHHHHHH
Purity > 95% by HPLC
Concentration 1mg/ml (determined by Absorbance at 280nm)
Formulation Liquid. In Phosphate Buffered Saline (pH 7.4) containing 10% glycerol.
Other Names Tumor-associated calcium signal transducer 2 , TACSTD2, EGP-1, EGP1, GA733-1, GA7331, GP50, M1S1, TROP2
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap