Home / Products / proteins / γ-Synuclein, Human, Recombinant, E.coli

γ-Synuclein, Human, Recombinant, E.coli

Categories: [Proteins / Peptides]
gamma-synuclein(Originally known as a breast cancer specific gene product, BCSG1) is an acidic neuronal protein of 127 amino acids. The protein coding region of gamma-synuclein was amplified by RT-PCR and cloned into an E.coli expression vector. gamma-synuclein was overexpressed in E. coli and purified to apparent homogeneity by taking advantage of the thermosolubility of the protein and by using conventional column chromatography techniques.
List Price: $256
  • Buy 5 for $243.2 each and save 5%
  • Buy 21 for $230.4 each and save 10%
  • Buy 31 for $217.6 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP04124
Size 100 µg
Host E.coli
Accession
Molecular Weight 13.3 kDa (127 aa), confirmed by MALDI-TOF. (Molecular weight on SDS-PAGE will appear higher)
AP_Mol_Weight
Tag
Sequences MDVFKKGFSIAKEGVVGAVEKTKQGVTEAAEKTKEGVMYVGAKTKENVVQSVTSVAEKTKEQANAVSEAVVSSVNTVATKTVEEAENIAVTSGVVRKEDLRPSAPQQEGVASKEKEEVAEEAQSGGD
Purity > 95% by HPLC
Concentration 1 mg/ml (determined by BCA assay)
Formulation Liquid. In 20 mM Tris-HCl buffer (pH 7.5) containing 0.1 M NaCl
Other Names SNCG, BCSG1, PERSYN, PRSN, gamma-Synuclein , Persyn, Breast cancer-specific gene 1 protein, Synoretin, SR, gamma-synuclein, gamma synuclein, Synuclein, gamma (breast cancer-specific protein 1) BCSG 1, Breast cancer specific gene 1
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.
CONTACT US
How to order

Featured Products

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap