Data Sheet | Click for Datasheet |
---|---|
Catalog Number | TP04124 |
Size | 100 µg |
Host | E.coli |
Accession | |
Molecular Weight | 13.3 kDa (127 aa), confirmed by MALDI-TOF. (Molecular weight on SDS-PAGE will appear higher) |
AP_Mol_Weight | |
Tag | |
Sequences | MDVFKKGFSIAKEGVVGAVEKTKQGVTEAAEKTKEGVMYVGAKTKENVVQSVTSVAEKTKEQANAVSEAVVSSVNTVATKTVEEAENIAVTSGVVRKEDLRPSAPQQEGVASKEKEEVAEEAQSGGD |
Purity | > 95% by HPLC |
Concentration | 1 mg/ml (determined by BCA assay) |
Formulation | Liquid. In 20 mM Tris-HCl buffer (pH 7.5) containing 0.1 M NaCl |
Other Names | SNCG, BCSG1, PERSYN, PRSN, gamma-Synuclein , Persyn, Breast cancer-specific gene 1 protein, Synoretin, SR, gamma-synuclein, gamma synuclein, Synuclein, gamma (breast cancer-specific protein 1) BCSG 1, Breast cancer specific gene 1 |
Bioactivity | |
Storage | Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles. |
Postscript | For research use only, not for use in diagnostic procedures. |
© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap