α-Synuclein, Human, Recombinant, E.coli

Categories: [Proteins / Peptides]
alpha-Synuclein (amino acids 1-140), an acidic neuronal protein of 140 amino acids, is extremely heat-resistant and is natively unfolded with an extended structure primarily composed of random coils. alpha-synuclein has been suggested to be implicated in the pathogenesis of Parkinson's disease and related neurodegenerative disorders, and more recently, to be an important regulatory component of vesicular transport in neuronal cells. Moreover, recent studies have shown that alpha-synuclein has chaperone activity and that this activity is lost upon removing its C-terminal acidic tail (amino acids 96-140).
List Price: $243
  • Buy 5 for $230.85 each and save 5%
  • Buy 21 for $218.7 each and save 10%
  • Buy 31 for $206.55 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP04122
Size 100 µg
Host E.coli
Accession
Molecular Weight 14.4 kDa (140 aa), confirmed by MALDI-TOF. (Molecular weight on SDS-PAGE will appear higher)
AP_Mol_Weight
Tag
Sequences MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEA
Purity > 95% by HPLC
Concentration 1 mg/ml (determined by BCA assay)
Formulation In 20 mM Tris-HCl buffer (pH 7.5) containing 0.1 M NaCl,1mM MgCl2
Other Names SNCA, NACP, PARK1, alpha-Synuclein, Non-A beta component of AD amyloid, Non-A4 component of amyloid precursor, Alpha synuclein, Alpha-synuclein isoform NACP140, alphaSYN, MGC105443, MGC110988, MGC127560, MGC64356
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap