Home / Products / proteins / α-Synuclein E46K, Human, Recomninant, E.coli

α-Synuclein E46K, Human, Recomninant, E.coli

Categories: [Proteins / Peptides]
alpha-Synuclein E46K is a mutant form of alpha-synuclein which is changed at position 46 from glutamate(E) to lysine(K). Recent studies have shown that this mutant(E46K) of alpha-synuclein causes Parkinson and Lewy Body dementia(DLB). alpha-Synuclein E46K was overexpressed in E. coli and purified to apparent homogeneity by using conventional column chromatography techniques
List Price: $256
  • Buy 5 for $243.2 each and save 5%
  • Buy 21 for $230.4 each and save 10%
  • Buy 31 for $217.6 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP04120
Size 100 µg
Host E.coli
Accession
Molecular Weight 14.4 (140 aa), confirmed by MALDI-TOF. (Molecular weight on SDS-PAGE will appear higher)
AP_Mol_Weight
Tag
Sequences MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKKGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEA
Purity > 95% by HPLC
Concentration 1 mg/ml (determined by BCA assay)
Formulation Liquid. In 20 mM Tris-HCl buffer (pH 7.5) containing 0.1 M NaCl
Other Names SNCA, NACP, PARK1, alpha-Synuclein, alpha synuclein E46k, alpha-synuclein e46k, Non-A beta component of AD amyloid, Non-A4 component of amyloid precursor, Alpha synuclein, Alpha-synuclein isoform NACP140, alphaSYN
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.
CONTACT US
How to order

Featured Products

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap