Data Sheet | Click for Datasheet |
---|---|
Catalog Number | TP04114 |
Size | 100 µg |
Host | E.coli |
Accession | |
Molecular Weight | 11.3 kDa (112 aa), confirmed by MALDI-TOF. |
AP_Mol_Weight | |
Tag | |
Sequences | MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKEGYQDYEPEA |
Purity | > 95% by HPLC |
Concentration | 1 mg/ml (determined by BCA assay) |
Formulation | Liquid. In 20 mM Tris-HCl buffer (pH 7.5) containing 0.1 M NaCl |
Other Names | SNCA, NACP, PARK1, alpha-Synuclein, Non-A beta component of AD amyloid, Non-A4 component of amyloid precursor, Alpha synuclein, Alpha-synuclein isoform NACP140, alphaSYN, MGC105443, MGC110988, MGC127560, MGC64356 |
Bioactivity | |
Storage | Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles. |
Postscript | For research use only, not for use in diagnostic procedures. |
© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap