Home / Products / proteins / α-Synuclein 112(NACP112), Human, Recombinant, E.coli

α-Synuclein 112(NACP112), Human, Recombinant, E.coli

Categories: [Proteins / Peptides]
An alternatively spliced(103-129) form of alpha-synuclein. alpha-synuclein112 was cloned into an E. coli expression vector by RT-PCR.. The recombinant protein was purified to apparent homogeneity by taking advantage of the thermosolubility of the protein and by using conventional column chromatography techniques.
List Price: $256
  • Buy 5 for $243.2 each and save 5%
  • Buy 21 for $230.4 each and save 10%
  • Buy 31 for $217.6 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP04114
Size 100 µg
Host E.coli
Accession
Molecular Weight 11.3 kDa (112 aa), confirmed by MALDI-TOF.
AP_Mol_Weight
Tag
Sequences MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKEGYQDYEPEA
Purity > 95% by HPLC
Concentration 1 mg/ml (determined by BCA assay)
Formulation Liquid. In 20 mM Tris-HCl buffer (pH 7.5) containing 0.1 M NaCl
Other Names SNCA, NACP, PARK1, alpha-Synuclein, Non-A beta component of AD amyloid, Non-A4 component of amyloid precursor, Alpha synuclein, Alpha-synuclein isoform NACP140, alphaSYN, MGC105443, MGC110988, MGC127560, MGC64356
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.
CONTACT US
How to order

Featured Products

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap