α-Synuclein 1-95, Human, Recombinant, E.coli

Categories: [Proteins / Peptides]
A deletion mutant of alpha-synuclein (amino acids 1-95), which contains the N-terminal amphipathic domain and NAC region. alpha-synuclein 1-95 was overexpressed in E. coli and the recombinant protein was purified to apparent homogeneity by using conventional column chromatography techniques.
List Price: $256
  • Buy 5 for $243.2 each and save 5%
  • Buy 21 for $230.4 each and save 10%
  • Buy 31 for $217.6 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP04113
Size 100 µg
Host E.coli
Accession
Molecular Weight 9.3 kDa (95 aa), confirmed by MALDI-TOF.
AP_Mol_Weight
Tag
Sequences MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFV
Purity > 95% by HPLC
Concentration 1 mg/ml (determined by BCA assay)
Formulation Liquid in 20 mM Tris-HCl buffer (pH 7.5) containing 0.1 M NaCl
Other Names SNCA, NACP, PARK1, alpha-Synuclein, Non-A beta component of AD amyloid, Non-A4 component of amyloid precursor, Alpha synuclein, Alpha-synuclein isoform NACP140, alphaSYN, MGC105443, MGC110988, MGC127560, MGC64356
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap