Syndecan 4, 19-145aa, Human, E.coli

Categories: [Proteins / Peptides]
Syndecan 4 belongs to syndecan proteoglycan family (type I integral membrane proteoglycans) that are involved in cell-extracellular matrix adhesion and growth factor binding. This protein functions cooperatively with integrins in the processes of cell spreading and focal adhesion assembly. It is also a transmembrane protein specifically enriched in Schwann cell perinodal processes. Recombinant Syndecan 4 protein was expressed in E.coli and purified by using conventional chromatography techniques.
List Price: $731
  • Buy 5 for $694.45 each and save 5%
  • Buy 21 for $657.9 each and save 10%
  • Buy 31 for $621.35 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP04109
Size 100 µg
Host E.coli
Accession
Molecular Weight 13.9 kDa (128aa), confirmed by MALDI-TOF.
AP_Mol_Weight
Tag
Sequences MESIRETEVIDPQDLLEGRYFSGALPDDEDVVGPGQESDDFELSGSGDLDDLEDSMIGPEVVHPLVPLDNHIPERAGSGSQVPTEPKKLEENEVIPKRISPVEESEDVSNKVSMSSTVQGSNIFERTE
Purity > 95% by HPLC
Concentration 1 mg/ml (determined by Bradford assay)
Formulation Liquid. 20mM Tris-HCl buffer (pH8.0) containing 10% glycerol
Other Names SDC4, SYND4, syndecan 4, syndecan 4 (amphiglycan, ryudocan), amphiglycan, ryudocan, syndecan proteoglycan 4
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap