Data Sheet | Click for Datasheet |
---|---|
Catalog Number | TP04108 |
Size | 100 µg |
Host | E.coli |
Accession | |
Molecular Weight | 13.8 kDa (126 aa) |
AP_Mol_Weight | |
Tag | |
Sequences | MRGSHHHHHHGMASMTGGQQMGRDLYDDDDKDRWGSHMSATAATAPPAAPAGEGGPPAPPPNLTSNRRLQQTQAQVDEVVDIMRVNVDKVLERDQKLSELDDRADALQAGASQFETSAAKLKRKYW |
Purity | > 95% by HPLC |
Concentration | 1 mg/ml (determined by Bradford assay) |
Formulation | Liquid. In Phosphate-buffered saline (pH 7.4), 1mM EDTA |
Other Names | VAMP2, SYB2, Synaptobrevin 2, VAMP-2, Synaptobrevin-2, Vesicle-associated membrane protein 2, vesicle-associated membrane protein 2 FLJ11460, RATVAMPB, RATVAMPIR, SYB, VAMP 2 |
Bioactivity | |
Storage | Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles. |
Postscript | For research use only, not for use in diagnostic procedures. |
© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap