Home / Products / proteins / Synaptobrevin 1,1-91 aa, Human, Recombinant, His- tagged, E.coli

Synaptobrevin 1,1-91 aa, Human, Recombinant, His- tagged, E.coli

Categories: [Proteins / Peptides]
Synaptobrevin 1(Vehicle-associated membrane, VAMP1) is one of the key proteins in the SNARE complex which is involved in regulated exocytosis. Synaptobrevin1 binds to t-SNAREs, syntaxin (STX) and SNAP25, after the fusion of synaptic vesicles to plasma membrane. Recombinant human Synaptobrevin1, fused to His- tag at N-terminus, was expressed in E.coli and purified by using conventional chromatography techniques.
List Price: $355
  • Buy 5 for $337.25 each and save 5%
  • Buy 21 for $319.5 each and save 10%
  • Buy 31 for $301.75 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP04107
Size 100 µg
Host E.coli
Accession
Molecular Weight 11.9 kDa (111 aa), confirmed by MALDI-TOF.
AP_Mol_Weight
Tag
Sequences MGSSHHHHHHSSGLVPRGSHMSAPAQPPAEGTEGTAPGGGPPGPPPNMTSNRRLQQTQAQVEEVVDIIRVNVDKVLERDQKLSELDDRADALQAGASQFESSAAKLKRKYW
Purity > 95% by HPLC
Concentration 1 mg/ml (determined by Bradford assay)
Formulation In Phosphate-buffered saline (pH 7.4), 1mM EDTA
Other Names VAMP1, SYB1, Synaptobrevin 1, VAMP-1, Synaptobrevin-1, Vesicle-associated membrane protein 1, Vesicle-associated membrane protein 1 isoform 1 DKFZp686H12131, SYB 1, Synaptobrevin1, VAMP 1
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.
CONTACT US
How to order

Featured Products

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap