SYF2, 94-243aa, Human, His tag, E.coli

Categories: [Proteins / Peptides]
SYF2, also known as pre-mRNA-splicing factor SYF2, may be involved in pre-mRNA splicing. This protein interacts with cyclin D-type binding-protein 1, which is thought to be a cell cycle regulator at the G1/S transition. It is abundantly expressed in the heart, skeletal muscle and kidney and is expressed at lower levels in other tissues. Recombinant human SYF2 protein, fused to His-tag at N-terminus, was expressed in E.coli and purified by conventional chromatography, after refolding of the isolated inclusion bodies in a renaturation buffer.
List Price: $365
  • Buy 5 for $346.75 each and save 5%
  • Buy 21 for $328.5 each and save 10%
  • Buy 31 for $310.25 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP04106
Size 10 µg
Host E.coli
Accession
Molecular Weight 20.5 kDa (173aa), confirmed by MALDI-TOF
AP_Mol_Weight
Tag N-6His
Sequences MGSSHHHHHHSSGLVPRGSHMGSDYEKVKLLEISAEDAERWERKKKRKNPDLGFSDYAAAQLRQYHRLTKQIKPDMETYERLREKHGEEFFPTSNSLLHGTHVPSTEEIDRMVIDLEKQIEKRDKYSRRRPYNDDADIDYINERNAKFNKKAERFYGKYTAEIKQNLERGTAV
Purity > 95% by HPLC
Concentration 0.25 mg/ml (determined by Bradford assay)
Formulation Liquid. 20mM Tris-HCl buffer (pH8.0) containing 50% glycerol, 0.2M NaCl, 5mM DTT, 2mM EDTA
Other Names Pre-mRNA-splicing factor SYF2, CBPIN, GCIPIP, p29
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap