SYCE3, 1-88aa, Human, His tag, E.coli

Categories: [Proteins / Peptides]
SYCE3(synaptonemal complex central element protein 3) is major component of the transverse central element of synaptonemal complexes (SCS). The synaptonemal complex is a protein structure that forms between homologous chromosomes (two pairs of sister chromatids) during meiosis and that is thought to mediate chromosome pairing, synapsis, and recombination (crossing-over). This protein required for chromosome loading of the central element-specific SCS proteins, and for initiating synapsis between homologous chromosomes. Recombinant human SYCE3 protein, fused to His-tag at N-terminus, was expressed in E.coli and purified by using conventional chromatography techniques.
List Price: $310
  • Buy 5 for $294.5 each and save 5%
  • Buy 21 for $279 each and save 10%
  • Buy 31 for $263.5 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP04105
Size 20 µg
Host E.coli
Accession
Molecular Weight 12.8 kDa (108aa), confirmed by MALDI-TOF
AP_Mol_Weight
Tag N-6His
Sequences MGSSHHHHHHSSGLVPRGSHMDDADPEERNYDNMLKMLSDLNKDLEKLLEEMEKISVQATWMAYDMVVMRTNPTLAESMRRLEDAFVNCKEEMEKNWQELLHETKQRL
Purity > 95% by HPLC
Concentration 0.5 mg/ml (determined by Bradford assay)
Formulation Liquid. In 20mM Tris-HCl buffer (pH 8.0) containing 0.2M NaCl, 20% glycerol, 2mM DTT
Other Names synaptonemal complex central element protein 3, testis highly expressed protein 2, C22orf41, chromosome 22 open reading frame 41, THEG-2, THEG2, SYCE-3
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap