Home / Products / proteins / Survivin, 1-142aa, Human, CaM-tagged, Recombinant, E.coli

Survivin, 1-142aa, Human, CaM-tagged, Recombinant, E.coli

Categories: [Proteins / Peptides]
Survivin is a human gene that is part of the inhibitor of apoptosis family (IAP). The Survivin protein functions to inhibit caspase activation therefore leading to negative regulation of apoptosis or programmed cell death. Recombinant human Survivin fused to CaM-tag at N-terminus was expressed in E.coli and purified by conventional chromatography techniques.
List Price: $355
  • Buy 5 for $337.25 each and save 5%
  • Buy 21 for $319.5 each and save 10%
  • Buy 31 for $301.75 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP04103
Size 100 µg
Host E.coli
Accession
Molecular Weight 33 kDa (294 aa), confirmed by MALDI-TOF.
AP_Mol_Weight
Tag
Sequences MADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVQMMTAKGSHMGAPTLPPAWQPFLKDHRISTFKNWPFLEGCACTPERMAEAGFIHCPTENEPDLAQCFFCFKELEGWEPDDDPIEEHKKHSSGCAFLSVKKQFEELTLGEFLKLDRERAKNKIAKETNNKKKEFEETAKKVRRAIEQLAAMD
Purity > 95% by HPLC
Concentration 1 mg/ml (determined by Bradford assay)
Formulation Liquid in 20mM Tris pH 7.5, 0.1M NaCl.
Other Names BIRC5, Baculoviral IAP repeat-containing 5, API4, EPR-1, Baculoviral IAP repeat-containing protein 5 isoform 1, Survivin, Baculoviral IAP repeat-containing protein 5 isoform 1 API4, Apoptosis Inhibitor 4
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.
CONTACT US
How to order

Featured Products

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap