Data Sheet | Click for Datasheet |
---|---|
Catalog Number | TP04103 |
Size | 100 µg |
Host | E.coli |
Accession | |
Molecular Weight | 33 kDa (294 aa), confirmed by MALDI-TOF. |
AP_Mol_Weight | |
Tag | |
Sequences | MADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVQMMTAKGSHMGAPTLPPAWQPFLKDHRISTFKNWPFLEGCACTPERMAEAGFIHCPTENEPDLAQCFFCFKELEGWEPDDDPIEEHKKHSSGCAFLSVKKQFEELTLGEFLKLDRERAKNKIAKETNNKKKEFEETAKKVRRAIEQLAAMD |
Purity | > 95% by HPLC |
Concentration | 1 mg/ml (determined by Bradford assay) |
Formulation | Liquid in 20mM Tris pH 7.5, 0.1M NaCl. |
Other Names | BIRC5, Baculoviral IAP repeat-containing 5, API4, EPR-1, Baculoviral IAP repeat-containing protein 5 isoform 1, Survivin, Baculoviral IAP repeat-containing protein 5 isoform 1 API4, Apoptosis Inhibitor 4 |
Bioactivity | |
Storage | Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles. |
Postscript | For research use only, not for use in diagnostic procedures. |
© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap