Home / Products / proteins / SUMO1, 1-101 aa, Human, His tag E.coli

SUMO1, 1-101 aa, Human, His tag E.coli

Categories: [Proteins / Peptides]
SUMO1, also known as small ubiquitin-related modifier 1, is a member of the SUMO protein family and functions in a manner similar to ubiquitin. However, unlike ubiquitin which targets proteins for degradation, SUMO1 protein participates in a number of cellular processes, such as nuclear transport, transcriptional regulation, apoptosis, and protein stability. Recombinant human SUMO1 protein, fused to His-tag at C-terminus, was expressed in E.coli and purified by using conventional chromatography techniques.
List Price: $365
  • Buy 5 for $346.75 each and save 5%
  • Buy 21 for $328.5 each and save 10%
  • Buy 31 for $310.25 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP04098
Size 100 µg
Host E.coli
Accession
Molecular Weight 12.6 kDa (109aa), confirmed by MALDI-TOF (Molecular weight on SDS-PAGE will appear higher)
AP_Mol_Weight
Tag N-6His
Sequences MSDQEAKPSTEDLGDKKEGEYIKLKVIGQDSSEIHFKVKMTTHLKKLKESYCQRQGVPMNSLRFLFEGQRIADNHTPKELGMEEEDVIEVYQEQTGGHSTVLEHHHHHH
Purity > 95% by HPLC
Concentration 1 mg/ml (determined by Bradford)
Formulation Liquid. In 20mM Tris-HCl buffer(pH 8.0) containing 10% glycerol, 1mM DTT, 0.15M NaCl
Other Names small ubiquitin-related modifier 1, DAP-1, GMP1, OFC10, PIC1, SENP2, SMT3,SMT3C, SMT3H3, SUMO-1, UBL1
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.
CONTACT US
How to order

Featured Products

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap