SUMO-3, 1-92aa, Human, His tag, E.coli

Categories: [Proteins / Peptides]
SUMO3, also known as small ubiquitin-related modifier 3, is a member of the SUMO protein family and functions in a manner similar to ubiquitin. However, unlike ubiquitin which targets proteins for degradation, SUMO3 protein participates in a number of cellular processes, such as nuclear transport, transcriptional regulation, apoptosis, and protein stability. It regulates amyloid beta generation and may be critical in the onset or progression of Alzheimer's disease. Recombinant human SUMO3 protein, fused to His-tag at N-terminus, was expressed in E.coli and purified by using conventional chromatography.
List Price: $365
  • Buy 5 for $346.75 each and save 5%
  • Buy 21 for $328.5 each and save 10%
  • Buy 31 for $310.25 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP04097
Size 100 µg
Host E.coli
Accession
Molecular Weight 12.6 kDa (112aa) confirmed by MALDI-TOF (molecular weight on SDS-PAGE will appear higher)
AP_Mol_Weight
Tag N-6His
Sequences MGSSHHHHHHSSGLVPRGSHMSEEKPKEGVKTENDHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQQQTGG
Purity > 95% by HPLC
Concentration 1.0 mg/ml (determined by BCA assay)
Formulation 0.1M NaClLiquid. 20mM Tris-HCl buffer (pH8.0) containing 20% glycerol, 0.1M NaCl,1mM DTT
Other Names Small ubiquitin-related modifier 3, SMT3A, SMT3H1, SUMO-3, sumo3, sumo 3
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap