SUMO-2, 1-93 aa, Human,Recombinant, E.coli

Categories: [Proteins / Peptides]
Small ubiquitin-related modifier 2 (SUMO-2) is a member of the SUMO protein family and functions in a manner similar to ubiquitin. However, unlike ubiquitin which targets proteins for degradation, SUMO-2 protein is involved in diverse cellular processes such as nuclear transport, DNA replication and repair, mitosis and signal transduction. This protein is not active until the last two amino acids of the carboxy-terminus have been cleaved off. Recombinant human SUMO2 protein was expressed in E.coli and purified by using conventional chromatography.
List Price: $316
  • Buy 5 for $300.2 each and save 5%
  • Buy 21 for $284.4 each and save 10%
  • Buy 31 for $268.6 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP04096
Size 100 µg
Host E.coli
Accession
Molecular Weight 10.6 kDa (93aa), confirmed by MALDI-TOF.
AP_Mol_Weight
Tag
Sequences MADEKPKEGVKTENNDHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQQQTGG
Purity > 95% by HPLC
Concentration 1 mg/ml (determined by Bradford assay)
Formulation Liquid. In 20 mM Tris-HCl buffer (pH 8.0)
Other Names Small ubiquitin-related modifier 2 , SUMO-2, SUMO-3, Sentrin-2, HSMT3, SMT3B, SMT3H2, Small ubiquitin-related modifier 2 SMT3 suppressor of mif two 3 homolog 2 (S, cerevisiae), HSMT 3, MGC117191, Sentrin 2, Sentrin2
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap