Home / Products / proteins / SUMO-1, 1-97 aa, Human, Recombinant, E.coli

SUMO-1, 1-97 aa, Human, Recombinant, E.coli

Categories: [Proteins / Peptides]
SUMO-1, also known as small ubiquitin-related modifier 1, is a member of the SUMO protein family and functions in a manner similar to ubiquitin. However, unlike ubiquitin which targets proteins for degradation, SUMO-1 protein participates in a number of cellular processes, such as nuclear transport, transcriptional regulation, apoptosis, and protein stability. Recombinant human SUMO1 protein was expressed in E.coli and purified by using conventional chromatography.
List Price: $329
  • Buy 5 for $312.55 each and save 5%
  • Buy 21 for $296.1 each and save 10%
  • Buy 31 for $279.65 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP04095
Size 100 µg
Host E.coli
Accession
Molecular Weight 11.1 kDa (97aa), confirmed by MALDI-TOF. (Molecular weight on SDS-PAGE will appear higher)
AP_Mol_Weight
Tag
Sequences MSDQEAKPSTEDLGDKKEGEYIKLKVIGQDSSEIHFKVKMTTHLKKLKESYCQRQGVPMNSLRFLFEGQRIADNHTPKELGMEEEDVIEVYQEQTGG
Purity > 95% by HPLC
Concentration 1 mg/ml (determined by Bradford assay)
Formulation Liquid. In 20 mM Tris-HCl buffer (pH 8.0) containing 10% glycerol
Other Names SMT3 suppressor of mif two 3 homolog 1 isoform a, DAP-1, GMP1, OFC10, PIC1, SENP2, SMT3, SMT3C, SMT3H3, UBL1 , SMT3 suppressor of mif two 3 homolog 1 isoform a GAP modifying protein 1, GMP 1, PIC 1, Sentrin, Sentrin 1
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.
CONTACT US
How to order

Featured Products

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap