SULT2A1, 1-285aa, Human, His tag, E.coli

Categories: [Proteins / Peptides]
SULT2A1, also known dehydroepiandrosterone sulphotransferase, belongs to the sulfotransferase family. This protein is mainly expressed in liver and adrenal tissues, and to a lesser extent in kidney. It catalyzes the 3'-phosphoadenosine 5'-phosphosulfate-dependent sulfation of a wide variety of steroids in human liver and adrenal tissues, and is also responsible for most of the sulfation of bile acids in human liver. Recombinant human SULT2A1 protein, fused to His-tag at N-terminus, was expressed in E.coli and purified by using conventional chromatography.
List Price: $365
  • Buy 5 for $346.75 each and save 5%
  • Buy 21 for $328.5 each and save 10%
  • Buy 31 for $310.25 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP04092
Size 100 µg
Host E.coli
Accession
Molecular Weight 35.9 kDa (305aa), confirmed by MALDI-TOF
AP_Mol_Weight
Tag N-6His
Sequences MGSSHHHHHHSSGLVPRGSHMSDDFLWFEGIAFPTMGFRSETLRKVRDEFVIRDEDVIILTYPKSGTNWLAEILCLMHSKGDAKWIQSVPIWERSPWVESEIGYTALSETESPRLFSSHLPIQLFPKSFFSSKAKVIYLMRNPRDVLVSGYFFWKNMKFIKKPKSWEEYFEWFCQGTVLYGSWFDHIHGWMPMREEKNFLLLSYEELKQDTGRTIEKICQFLGKTLEPEELNLILKNSSFQSMKENKMSNYSLLSVDYVVDKAQLLRKGVSGDWKNHFTVAQAEDFDKLFQEKMADLPRELFPWE
Purity > 95% by HPLC
Concentration 1.0 mg/ml (determined by Bradford assay)
Formulation Liquid. 20mM Tris-HCl buffer (pH8.0) containing 20% glycerol, 0.1M NaCl,1mM DTT
Other Names Bile salt sulfotransferase, DHEA-ST, DHEAS, HST, hSTa, ST2, ST2A1, ST2A3
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap