SULT1B1, 1-296aa, Human, His tag, E.coli

Categories: [Proteins / Peptides]
Sulfotransferase family, cytosolic, 1B, member 1, also known as SULT1B1, is an enzyme that in humans is encoded by the SULT1B1 gene. SULT1B1 contains a binding site for the sulfate donor, 3-prime-phosphoadenosine 5-prime-phosphosulfate, and a cysteine residue conserved in the ST1 gene family of sulfotransferases. Sulfotransferases such as SULT1B1 catalyze the biotransformation of a large number of endogenous compounds such as neurotransmitters, steroids, bile acids, and thyroid hormones, as well as drugs and xenobiotics. Recombinant human SULT1B1 protein, fused to His-tag at N-terminus, was expressed in E.coli and purified by using conventional chromatography techniques.
List Price: $365
  • Buy 5 for $346.75 each and save 5%
  • Buy 21 for $328.5 each and save 10%
  • Buy 31 for $310.25 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP04089
Size 100 µg
Host E.coli
Accession
Molecular Weight 37.4kDa (320aa), confirmed by MALDI-TOF
AP_Mol_Weight
Tag N-6His
Sequences MGSSHHHHHHSSGLVPRGSHMGSHMLSPKDILRKDLKLVHGYPMTCAFASNWEKIEQFHSRPDDIVIATYPKSGTTWVSEIIDMILNDGDIEKCKRGFITEKVPMLEMTLPGLRTSGIEQLEKNPSPRIVKTHLPTDLLPKSFWENNCKMIYLARNAKDVSVSYYHFDLMNNLQPFPGTWEEYLEKFLTGKVAYGSWFTHVKNWWKKKEEHPILFLYYEDMKENPKEEIKKIIRFLEKNLNDEILDRIIHHTSFEVMKDNPLVNYTHLPTTVMDHSKSPFMRKGTAGDWKNYFTVAQNEKFDAIYETEMSKTALQFRTEI
Purity > 95% by HPLC
Concentration 1 mg/ml (determined by Bradford assay)
Formulation Liquid. In 20mM Tris-HCl buffer (pH 8.0) containing 0.1M NaCl, 10% glycerol
Other Names Sulfotransferase family, cytosolic, 1B, member 1, ST1B1, ST1B2, SULT1B2
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap