SUGT1, 115-365aa, Human, His tag, E.coli

Categories: [Proteins / Peptides]
SUGT1, also known as suppressor of G2 allele of SKP1, is a homolog of the yeast protein SGT1, a regulator of the cell cycle that is essential for G1/S and G2/M transitions. It contains a CS domain, a SGS domain, a p23 domain and three tetratricopeptide repeats (TPR). This protein associates with Skp1 p19 and CUL-1, subunits of the SCF ubiquitin ligase complex, and is thought to play a role in protein degradation. In addition, it is required for the kinetochores assembly, and has function as a co-chaperone for HSP90. Recombinant human SUGT1 protein, fused to His-tag at N-terminus, was expressed in E.coli and purified by using conventional chromatography.
List Price: $365
  • Buy 5 for $346.75 each and save 5%
  • Buy 21 for $328.5 each and save 10%
  • Buy 31 for $310.25 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP04087
Size 100 µg
Host E.coli
Accession
Molecular Weight 30.7 kDa (272aa), confirmed by MALDI-TOF
AP_Mol_Weight
Tag N-6His
Sequences MGSSHHHHHHSSGLVPRGSHMHRVGQAGLQLLTSSDPPALDSQSAGITGADANFSVWIKRCQEAQNGSESEVWTHQSKIKYDWYQTESQVVITLMIKNVQKNDVNVEFSEKELSALVKLPSGEDYNLKLELLHPIIPEQSTFKVLSTKIEIKLKKPEAVRWEKLEGQGDVPTPKQFVADVKNLYPSSSPYTRNWDKLVGEIKEEEKNEKLEGDAALNRLFQQIYSDGSDEVKRAMNKSFMESGGTVLSTNWSDVGKRKVEINPPDDMEWKKY
Purity > 95% by HPLC
Concentration 0.5 mg/ml (determined by Bradford assay)
Formulation Liquid. 20mM Tris-HCl buffer (pH8.0) containing 20% glycerol 1mM DTT, 0.1M NaCl
Other Names Suppressor of G2 allele of SKP1 homolog isoform SGT1B, SGT1
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap