SUB1, 1-127aa, Human, His tag, E.coli

Categories: [Proteins / Peptides]
SUB1, also known as PC4, is a general coactivator that functions cooperatively with TAFs and mediates functional interactions between upstream activators and the general transcriptional machinery. SUB1 interacts with the activation domain of transcription factor IIA (TFIIA) and TATA-binding protein (TBP)-associated factors (TAFs) to directly bind to double stranded DNA. This protein induces both activation and repression of RNAPII basal transcription, depending on the presence or absence of these transcription factors and holoenzyme components. Recombinant human SUB1 protein, fused to His-tag at N-terminus, was expressed in E.coli and purified by using conventional chromatography techniques.
List Price: $310
  • Buy 5 for $294.5 each and save 5%
  • Buy 21 for $279 each and save 10%
  • Buy 31 for $263.5 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP04085
Size 50 µg
Host E.coli
Accession
Molecular Weight 16.5 kDa (147aa) confirmed by MALDI-TOF
AP_Mol_Weight
Tag N-6His
Sequences MGSSHHHHHHSSGLVPRGSHMPKSKELVSSSSSGSDSDSEVDKKLKRKKQVAPEKPVKKQKTGETSRALSSSKQSSSSRDDNMFQIGKMRYVSVRDFKGKVLIDIREYWMDPEGEMKPGRKGISLNPEQWSQLKEQISDIDDAVRKL
Purity > 95% by HPLC
Concentration 0.5 mg/ml (determined by Bradford assay)
Formulation Liquid. In 20 mM Tris-HCl buffer (pH8.0) containing 0.2M NaCl, 5mM DTT, 20% glycerol
Other Names : p14, P15, PC4, Activated RNA polymerase II transcriptional coactivator p15 Activated RNA polymerase II transcriptional coactivator p15, Interferon related developmental regulator 1, MGC102747, PC4 LSB, Positive cofactor 4, RPO2TC1, SUB1, SUB1 homolog.
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap