Home / Products / proteins / STX1A, 1-265aa, Human, E.coli

STX1A, 1-265aa, Human, E.coli

Categories: [Proteins / Peptides]
STX1A, also as known as syntaxin 1A, is a synaptic protein implicated in docking of synaptic vesicles at presynaptic active zones. This protein plays a role in hormone and neurotransmitter exocytosis and may mediate Ca2+-regulation of exocytosis acrosomal reaction in sperm. Recombinant human STX1A was expressed in E.coli and purified by using conventional chromatography techniques.
List Price: $302
  • Buy 5 for $286.9 each and save 5%
  • Buy 21 for $271.8 each and save 10%
  • Buy 31 for $256.7 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP04077
Size 20 µg
Host E.coli
Accession
Molecular Weight 30.7kDa (265aa), confirmed by MALDI-TOF
AP_Mol_Weight
Tag
Sequences MKDRTQELRTAKDSDDDDDVAVTVDRDRFMDEFFEQVEEIRGFIDKIAENVEEVKRKHSAILASPNPDEKTKEELEELMSDIKKTANKVRSKLKSIEQSIEQEEGLNRSSADLRIRKTQHSTLSRKFVEVMSEYNATQSDYRERCKGRIQRQLEITGRTTTSEELEDMLESGNPAIFASGIIMDSSISKQALSEIETRHSEIIKLENSIRELHDMFMDMAMLVESQGEMIDRIEYNVEHAVDYVERAVSDTKKAVKYQSKARRKK
Purity > 95% by HPLC
Concentration 1mg/ml (determined by Bradford assay)
Formulation Liquid. In phosphate buffered saline (pH 7.4) containing 10% glycerol, 1mM DTT
Other Names Syntaxin 1A , HPC-1, P35-1, STX1, SYN1A, , Neuron specific antigen HPC1, Neuron-specific antigen HPC-1OTTHUMP00000174615, OTTHUMP00000174616OTTHUMP00000174617, OTTHUMP00000174618P35-1.
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.
CONTACT US
How to order

Featured Products

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap