Stathmin, 1-149aa, Human, His-tagged, Recombinant, E.coli

Categories: [Proteins / Peptides]
Stathmin is a ubiquitous phosphoprotein proposed to play a general role as an intracellular relay integrating diverse regulatory signals of the cellular environment. Also, Stathmin protein is involved in the regulation of the microtubule filament system by destabilizing microtubules. It prevents assembly and promotes disassembly of microtubules. The role of Stathmin in regulation of the cell cycle causes it to be an oncoprotein (Oncoprotein 18, op18). When Stathmin is mutated and not functioning properly, this protein can cause uncontrolled cell proliferation. Recombinant human Stathmin protein, fused to His-tag at N-terminus, was expressed in E.coli and purified by using conventional chromatography techniques.
List Price: $365
  • Buy 5 for $346.75 each and save 5%
  • Buy 21 for $328.5 each and save 10%
  • Buy 31 for $310.25 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP04054
Size 100 µg
Host E.coli
Accession
Molecular Weight 19.4 kDa (169aa), confirmed by MALDI-TOF.
AP_Mol_Weight
Tag
Sequences MGSSHHHHHHSSGLVPRGSHMASSDIQVKELEKRASGQAFELILSPRSKESVPEFPLSPPKKKDLSLEEIQKKLEAAEERRKSHEAEVLKQLAEKREHEKEVLQKAIEENNNFSKMAEEKLTHKMEANKENREAQMAAKLERLREKDKHIEEVRKNKESKDPADETEAD
Purity > 95% by HPLC
Concentration 1 mg/ml (determined by Bradford assay)
Formulation Liquid. In 20 mM Tris-HCl buffer (pH 8.0) containing 10% glycerol
Other Names STMN1, Phosphoprotein p19 (pp19), Oncoprotein 18(Op18), pp17, Prosolin, Metablastin, LAP18 , Lag, LAP 18, Leukemia associated phosphoprotein p18, Metablastin, Oncoprotein 18, OP 18, OP18, p18, p19
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap