STARD5, 1-213aa, Human, His tag, E.coli

Categories: [Proteins / Peptides]
StAR-related lipid transfer protein 5, also known as STARD5, belongs to the STARD family of proteins is comprised of fifteen different members. All members contain the characteristic START domain and are believed to play key roles in the metabolism and transport of lipids. The STARD proteins are grouped into six subfamilies based on their START domain sequences. STARD5 constitute one subfamily, sharing approximately 30% amino acid identity with each other. STARD5 is not sterol-regulated but can be induced by endomplasmic reticulum (ER) stress. Due to its exclusive tissue expression and its interaction with sterols, StARD6 may function in reproduction and germ cell maturation. Recombinant human STARD5 protein, fused to His-tag at N-terminus, was expressed in E.coli and purified by using conventional chromatography techniques.
List Price: $365
  • Buy 5 for $346.75 each and save 5%
  • Buy 21 for $328.5 each and save 10%
  • Buy 31 for $310.25 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP04052
Size 100 µg
Host E.coli
Accession
Molecular Weight 26.2kDa (236aa) confirmed by MALDI-TOF
AP_Mol_Weight
Tag N-6His
Sequences MGSSHHHHHHSSGLVPRGSHMGSMDPALAAQMSEAVAEKMLQYRRDTAGWKICREGNGVSVSWRPSVEFPGNLYRGEGIVYGTLEEVWDCVKPAVGGLRVKWDENVTGFEIIQSITDTLCVSRTSTPSAAMKLISPRDFVDLVLVKRYEDGTISSNATHVEHPLCPPKPGFVRGFNHPCGCFCEPLPGEPTKTNLVTFFHTDLSGYLPQNVVDSFFPRSMTRFYANLQKAVKQFHE
Purity > 95% by HPLC
Concentration 1 mg/ml (determined by Bradford assay)
Formulation Liquid. In 20mM Tris-HCl buffer (pH 8.0) containing 0.1M NaCl, 20% glycerol, 1mM DTT
Other Names StAR-related lipid transfer protein 5,
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap