ST6GAL1, 27-406aa, Human, His tag, Baculovirus

Categories: [Proteins / Peptides]
ST6GAL1, also known as beta-galactoside alpha-2,6-sialyltransferase 1, is a type II membrane protein localized in the trans-Golgi network and catalyzes 2,6-sialylation of Gal beta 1,4-GlcNAc structures on N-glycans. It is highly expressed in the liver and also expressed in most other tissues to some extent. Its deficiency causes abnormalities in B cell immunoreactivity. Recombinant human ST6GAL1, fused to His-tag at C-terminus, was expressed in insect cell and purified by using conventional chromatography techniques.
List Price: $302
  • Buy 5 for $286.9 each and save 5%
  • Buy 21 for $271.8 each and save 10%
  • Buy 31 for $256.7 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP04045
Size 50 µg
Host Baculovirus
Accession
Molecular Weight 44.6kDa (389aa), 40-57kDa (SDS-PAGE under reducing conditions)
AP_Mol_Weight
Tag N-6His
Sequences ADPKEKKKGSYYDSFKLQTKEFQVLKSLGKLAMGSDSQSVSSSSTQDPHRGRQTLGSLRGLAKAKPEASFQVWNKDSSSKNLIPRLQKIWKNYLSMNKYKVSYKGPGPGIKFSAEALRCHLRDHVNVSMVEVTDFPFNTSEWEGYLPKESIRTKAGPWGRCAVVSSAGSLKSSQLGREIDDHDAVLRFNGAPTANFQQDVGTKTTIRLMNSQLVTTEKRFLKDSLYNEGILIVWDPSVYHSDIPKWYQNPDYNFFNNYKTYRKLHPNQPFYILKPQMPWELWDILQEISPEEIQPNPPSSGMLGIIIMMTLCDQVDIYEFLPSKRKTDVCYYYQKFFDSACTMGAYHPLLYEKNLVKHLNQGTDEDIYLLGKATLPGFRTIHCHHHHHH
Purity > 95% by HPLC
Concentration 0.5mg/ml (determined by Absorbance at 280nm)
Formulation Liquid. In Phosphate Buffered Saline (pH 7.4) containing 10% glycerol.
Other Names Beta-galactoside alpha-2,6-sialyltransferase 1, ST6GAL1, SIAT1, ST6GalI, ST6N
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap