SSU72, 1-194aa, Human, His tag, E.coli

Categories: [Proteins / Peptides]
SSU72 RNA polymerase II CTD phosphatase homolog, also known as SSU72, is a highly conserved homologue of yeast Ssu72, a CTD phosphatase and a component of the polyadenylation/ termination machinery. Existing as multiple alternatively spliced isoforms, SSU72 interacts with TFIIB, Rb and DNAM-1 and functions to catalyze the dephosphorylation of target proteins, possibly playing a role in RNA processing and termination via dephosphorylation of Pol II. Recombinant human SSU72 protein, fused to His-tag at N-terminus, was expressed in E.coli and purified by using conventional chromatography techniques.
List Price: $365
  • Buy 5 for $346.75 each and save 5%
  • Buy 21 for $328.5 each and save 10%
  • Buy 31 for $310.25 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP04041
Size 100 µg
Host E.coli
Accession
Molecular Weight 25 kDa (217aa), confirmed by MALDI-TOF
AP_Mol_Weight
Tag N-6His
Sequences MGSSHHHHHHSSGLVPRGSHMGSMPSSPLRVAVVCSSNQNRSMEAHNILSKRGFSVRSFGTGTHVKLPGPAPDKPNVYDFKTTYDQMYNDLLRKDKELYTQNGILHMLDRNKRIKPRPERFQNCKDLFDLILTCEERVYDQVVEDLNSREQETCQPVHVVNVDIQDNHEEATLGAFLICELCQCIQHTEDMENEIDELLQEFEEKSGRTFLHTVCFY
Purity > 95% by HPLC
Concentration 1 mg/ml (determined by Bradford assay)
Formulation Liquid. In 20mM Tris-HCl buffer (pH 8.0) containing 1mM DTT, 10% glycerol, 0.1M NaCl
Other Names SSU72 RNA polymerase II CTD phosphatase homolog, HSPC182, PNAS-120
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap