SRA1, 90-236aa, Human, His tag, E.coli

Categories: [Proteins / Peptides]
Steroid receptor RNA activator 1, also known as SRA1, exists as both a RNA transcript and as stably expressed proteins. Also this protein mediates transcriptional coactivation of steroid receptors ligand-dependently through the steroid-binding domain (AF-2). SRA1 enhances cellular proliferation and differentiation and promotes apoptosis in vivo. It may play a role in tumorigenesis. Recombinant human SRA1 protein, fused to His-tag at N-terminus, was expressed in E.coli and purified by using conventional chromatography techniques.
List Price: $310
  • Buy 5 for $294.5 each and save 5%
  • Buy 21 for $279 each and save 10%
  • Buy 31 for $263.5 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP04027
Size 20 µg
Host E.coli
Accession
Molecular Weight 18.7 kDa (170aa) confirmed by MALDI-TOF
AP_Mol_Weight
Tag N-6His
Sequences MGSSHHHHHHSSGLVPRGSHMGSVGSGPASGVEPTSFPVESEAVMEDVLRPLEQALEDCRGHTRKQVCDDISRRLALLQEQWAGGKLSIPVKKRMALLVQELSSHRWDAADDIHRSLMVDHVTEVSQWMVGVKRLIAEKRSLFSEEAANEEKSAATAEKNHTIPGFQQAS
Purity > 95% by HPLC
Concentration Lanz R B., et al. (1999) Cell. 97:17-27 Watanabe M., et al. (2001) EMBO J. 20: 1341-1352.
Formulation Liquid. In 20mM Tris-HCl buffer (pH 8.0) containing 0.1M NaCl, 10% glycerol,1mM DTT
Other Names Steroid receptor RNA activator 1, pp7684, SRA, SRAP, STRAA1
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap