SPSB1, 24-233aa, Human, His tag, E.coli

Categories: [Proteins / Peptides]
SPRY domain-containing SOCS box protein 1 (SPSB1), also known as SSB1, is a member of the SOCS box protein subfamily. This protein contains a central SPRY domain and a C-terminal SOCS box. Although some of the SOCS protein subfamilies function as adaptors for a large family of ubiquitin-protein isopeptide ligases to regulate certain signaling pathways, the function of the SSB subfamily remains to be determined. SPSB1 may play an important role in enhancing the HGF-induced Erk-Elk-1-SRE pathway. Over expression of SPSB1 exhibited no effect on the basal level or epidermal growth factor-induced SRE-luciferase activity. Recombinant human SPSB1 protein, fused to His-tag at N-terminus, was expressed in E.coli and purified by using conventional chromatography techniques.
List Price: $414
  • Buy 5 for $393.3 each and save 5%
  • Buy 21 for $372.6 each and save 10%
  • Buy 31 for $351.9 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP04024
Size 50 µg
Host E.coli
Accession
Molecular Weight 26.1 kDa (231aa) confirmed by MALDI-TOF
AP_Mol_Weight
Tag N-6His
Sequences MGSSHHHHHHSSGLVPRGSHMQELQGLDYCKPTRLDLLLDMPPVSYDVQLLHSWNNNDRSLNVFVKEDDKLIFHRHPVAQSTDAIRGKVGYTRGLHVWQITWAMRQRGTHAVVGVATADAPLHSVGYTTLVGNNHESWGWDLGRNRLYHDGKNQPSKTYPAFLEPDETFIVPDSFLVALDMDDGTLSFIVDGQYMGVAFRGLKGKKLYPVVSAVWGHCEIRMRYLNGLDPE
Purity > 95% by HPLC
Concentration 1 mg/ml (determined by Bradford assay )
Formulation Liquid. In 20mM Tris-HCl buffer (pH 8.0) containing 1mM DTT, 30% glycerol, 0.1M NaCl
Other Names SPRY domain-containing SOCS box protein 1, SSB-1, SSB1
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap