Home / Products / proteins / SPINT2, 28-197aa, Human, His tag, Insect cell

SPINT2, 28-197aa, Human, His tag, Insect cell

Categories: [Proteins / Peptides]
SPINT2, also known as kunitz-type protease inhibitor 2, inhibits HGF activator which prevents the formation of active hepatocyte growth factor. This protein has been identified as a putative tumor suppressor gene silenced by promoter methylation. Recombinant human SPINT2, fused to His-tag at C-terminus, was expressed in insect cell and purified by using conventional chromatography techniques.
List Price: $414
  • Buy 5 for $393.3 each and save 5%
  • Buy 21 for $372.6 each and save 10%
  • Buy 31 for $351.9 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP04018
Size 50 µg
Host Insect cell
Accession
Molecular Weight 20kDa (176aa) 18-28KDa (SDS-PAGE under reducing conditions.)
AP_Mol_Weight
Tag N-6His
Sequences ADRERSIHDFCLVSKVVGRCRASMPRWWYNVTDGSCQLFVYGGCDGNSNNYLTKEECLKKCATVTENATGDLATSRNAADSSVPSAPRRQDSEDHSSDMFNYEEYCTANAVTGPCRASFPRWYFDVERNSCNNFIYGGCRGNKNSYRSEEACMLRCFRQQENPPLPLGSKHHHHHH
Purity > 95% by HPLC
Concentration 0.2mg/ml (determined by absorbance at 280nm)
Formulation Liquid. In phosphate buffered saline (pH 7.4), 10% glycerol.
Other Names Kunitz-type protease inhibitor 2, DIAR3, HAI-2, HAI2, Kop, PB
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.
CONTACT US
How to order

Featured Products

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap