SPG21, 1-308 aa, Human, His-tagged, Recombinant, E.coli

Categories: [Proteins / Peptides]
Spastic paraplegia 21(SPG21), also known as Maspardin, binds to the hydrophobic C-terminal amino acids of CD4 and may play a role as a negative regulatory factor in CD4-depenent T-cell activation. This protein is widely expressed in various tissues including heart, brain, placenta, lung, liver, skeletal muscle, kidney and pancreas. Mutations in SPG21 cause Mast syndrome, an autosomal-recessive complicated form of hereditary spastic paraplegia characterized by dementia, thin corpus callosum and white matter abnormalities. Recombinant human SPG21 protein, fused to His-tag at N-terminus, was expressed in E.coli and purified by using conventional chromatography.
List Price: $365
  • Buy 5 for $346.75 each and save 5%
  • Buy 21 for $328.5 each and save 10%
  • Buy 31 for $310.25 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP04012
Size 100 µg
Host E.coli
Accession
Molecular Weight 37.1 kDa (328aa), confirmed by MALDI-TOF.
AP_Mol_Weight
Tag
Sequences MGSSHHHHHHSSGLVPRGSHMGEIKVSPDYNWFRGTVPLKKIIVDDDDSKIWSLYDAGPRSIRCPLIFLPPVSGTADVFFRQILALTGWGYRVIALQYPVYWDHLEFCDGFRKLLDHLQLDKVHLFGASLGGFLAQKFAEYTHKSPRVHSLILCNSFSDTSIFNQTWTANSFWLMPAFMLKKIVLGNFSSGPVDPMMADAIDFMVDRLESLGQSELASRLTLNCQNSYVEPHKIRDIPVTIMDVFDQSALSTEAKEEMYKLYPNARRAHLKTGGNFPYLCRSAEVNLYVQIHLLQFHGTKYAAIDPSMVSAEELEVQKGSLGISQEEQ
Purity > 95% by HPLC
Concentration 1 mg/ml (determined by Bradford assay)
Formulation Liquid. In 20 mM Tris-HCl buffer (pH 8.0)
Other Names ACP33, BM-019, GL010, Maspardin, MAST, Spastic paraplegia 21 isoform a Acid cluster protein 33, BM019, Spastic paraplegia 21 autosomal recessive Mast syndrome protein, SPG21.
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap