SOX2, 1-200aa, Human, His tag, E.coli

Categories: [Proteins / Peptides]
SRY (sex determining region Y)-box 2, also known as SOX2, is a transcription factor that is essential to maintain self-renewal of undifferentiated embryonic stem cells. This Protein is a member of the SRY-related HMG-box (SOX) family of transcription factors involved in the regulation of embryonic development and in the determination of cell fate. The product of this gene is required for stem-cell maintenance in the central nervous system, and also regulates gene expression in the stomach. Recombinant human SOX2 protein was expressed in E.coli and purified by using conventional chromatography techniques.
List Price: $316
  • Buy 5 for $300.2 each and save 5%
  • Buy 21 for $284.4 each and save 10%
  • Buy 31 for $268.6 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP04008
Size 100 µg
Host E.coli
Accession
Molecular Weight 23.1kDa (208aa), confirmed by MALDI-TOF.
AP_Mol_Weight
Tag N-6His
Sequences MYNMMETELKPPGPQQTSGGGGGNSTAAAAGGNQKNSPDRVKRPMNAFMVWSRGQRRKMAQENPKMHNSEISKRLGAEWKLLSETEKRPFIDEAKRLRALHMKEHPDYKYRPRRKTKTLMKKDKYTLPGGLLAPGGNSMASGVGVGAGLGAGVNQRMDSYAHMNGWSNGSYSMMQDQLGYPQHPGLNAHGAAQMQPMHRYLEHHHHHH
Purity > 95% by HPLC
Concentration 0.25 mg/ml (determined by Bradford assay)
Formulation Liquid. In 20mM Tris-HCl buffer (pH 8.0) containing 200mM NaCl, 2mM DTT, 40% glycerol
Other Names ANOP3, MCOPS3, MGC2413, SRY (sex determining region Y)-box 2 ANOP3, cb236, Delta EF2a, lcc, MGC148683, RGD1565646, Sex determining region Y box 2, SOX 2, SRY (sex determining region Y) box 2, SRY box containing gene 2
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap