Home / Products / proteins / SORD, 1-357aa, Human, E.coli (Bioactivity Validated)

SORD, 1-357aa, Human, E.coli (Bioactivity Validated)

Categories: [Proteins / Peptides]
SORD, also known as sorbitol dehydrogenase, is a member of the zinc-containing alcohol dehydrogenase family. It is widely expressed with highest expression in kidney and in the lens of the eye. SORD enzymatically catalyzes the zinc-dependent interconversion of polyols, such as sorbitol and xylitol, to their respective ketoses. Recombinant human SORD protein, was expressed in E.coli and purified by using conventional chromatography techniques.
List Price: $122
  • Buy 5 for $115.9 each and save 5%
  • Buy 21 for $109.8 each and save 10%
  • Buy 31 for $103.7 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP04005
Size 10 µg
Host E.coli
Accession
Molecular Weight 38.3kDa (357aa)
AP_Mol_Weight
Tag
Sequences MAAAAKPNNLSLVVHGPGDLRLENYPIPEPGPNEVLLRMHSVGICGSDVHYWEYGRIGNFIVKKPMVLGHEASGTVEKVGSSVKHLKPGDRVAIEPGAPRENDEFCKMGRYNLSPSIFFCATPPDDGNLCRFYKHNAAFCYKLPDNVTFEEGALIEPLSVGIHACRRGGVTLGHKVLVCGAGPIGMVTLLVAKAMGAAQVVVTDLSATRLSKAKEIGADLVLQISKESPQEIARKVEGQLGCKPEVTIECTGAEASIQAGIYATRSGGTLVLVGLGSEMTTVPLLHAAIREVDIKGVFRYCNTWPVAISMLASKSVNVKPLVTHRFPLEKALEAFETFKKGLGLKIMLKCDPSDQNP
Purity > 95% by HPLC
Concentration 0.5mg/ml (determined by Bradford assay)
Formulation Liquid. In 20mM Tris-HCl buffer(pH 8.5) containing 10% glycerol, 1mM DTT
Other Names SORD1
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.
CONTACT US
How to order

Featured Products

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap