sodA, 1-206aa, E.coli, His tag, E.coli

Categories: [Proteins / Peptides]
Superoxide dismutase, Mn, also known as sodA, is a member of the iron/manganese superoxide dismutase family. SodA destroys radicals which are normally produced within the cells and which are toxic to biological systems. It works by catalyzing the dismutation of the superoxide radical O2- to O2 and H2O2, which are then metabolized to H2O and O2 by catalase and glutathione peroxidase. Recombinant E.coli sodA protein, fused to His-tag at N-terminus, was expressed in E.coli and purified by using conventional chromatography techniques.
List Price: $365
  • Buy 5 for $346.75 each and save 5%
  • Buy 21 for $328.5 each and save 10%
  • Buy 31 for $310.25 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP03245
Size 100 µg
Host E.coli
Accession
Molecular Weight 25.2 kDa (226aa) confirmed by MALDI-TOF
AP_Mol_Weight
Tag N-6His
Sequences MGSSHHHHHHSSGLVPRGSHMSYTLPSLPYAYDALEPHFDKQTMEIHHTKHHQTYVNNANAALESLPEFANLPVEELITKLDQLPADKKTVLRNNAGGHANHSLFWKGLKKGTTLQGDLKAAIERDFGSVDNFKAEFEKAAASRFGSGWAWLVLKGDKLAVVSTANQDSPLMGEAISGASGFPIMGLDVWEHAYYLKFQNRRPDYIKEFWNVVNWDEAAARFAAKK
Purity > 95% by HPLC
Concentration 1 mg/ml (determined by Bradford assay )
Formulation Liquid. In 20mM Tris-HCl buffer (pH 8.0) containing 1mM DTT, 10% glycerol, 0.1M NaCl
Other Names Superoxide dismutase, manganese, MnSOD
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap